Protein Info for b4108 in Escherichia coli BW25113

Name: phnA
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00686: putative alkylphosphonate utilization operon protein PhnA
  • amino acids 2 to 111 (110 residues), 210.8 bits, E=1.6e-67
• PF08274: YjdM_Zn_Ribbon
  • amino acids 2 to 31 (30 residues), 60.4 bits, E=1.4e-20
• PF03831: YjdM
  • amino acids 44 to 111 (68 residues), 118.5 bits, E=9e-39

Best Hits

Swiss-Prot: 100% identical to YJDM_SHIFL: Protein YjdM (yjdM) from Shigella flexneri

KEGG orthology group: K06193, phosphonoacetate hydrolase [EC: 3.11.1.2] (inferred from 100% identity to eco:b4108)

Predicted SEED Role

"Alkylphosphonate utilization operon protein PhnA" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• phosphonoacetate degradation (1/1 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.2

Sequence Analysis Tools

See P0AFJ1 at UniProt or InterPro

Protein Sequence (111 amino acids)

>b4108 hypothetical protein (NCBI) (Escherichia coli BW25113)
MSLPHCPKCNSEYTYEDNGMYICPECAYEWNDAEPAQESDELIVKDANGNLLADGDSVTI
IKDLKVKGSSSMLKIGTKVKNIRLVEGDHNIDCKIDGFGPMKLKSEFVKKN