Protein Info for b4099 in Escherichia coli BW25113

Name: phnI
Annotation: carbon-phosphorus lyase complex subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF05861: PhnI" amino acids 1 to 350 (350 residues), 515.5 bits, see alignment E=3e-159

Best Hits

Swiss-Prot: 100% identical to PHNI_ECOLI: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI (phnI) from Escherichia coli (strain K12)

KEGG orthology group: K06164, PhnI protein (inferred from 100% identity to eco:b4099)

MetaCyc: 100% identical to carbon-phosphorus lyase core complex subunit PhnI (Escherichia coli K-12 substr. MG1655)
RXN-17954 [EC: 2.7.8.37]; 2.7.8.37 [EC: 2.7.8.37]

Predicted SEED Role

"PhnI protein" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P16687 at UniProt or InterPro

Protein Sequence (354 amino acids)

>b4099 carbon-phosphorus lyase complex subunit (NCBI) (Escherichia coli BW25113)
MYVAVKGGEKAIDAAHALQESRRRGDTDLPELSVAQIEQQLNLAVDRVMTEGGIADRELA
ALALKQASGDNVEAIFLLRAYRTTLAKLAVSEPLDTTGMRLERRISAVYKDIPGGQLLGP
TYDYTHRLLDFTLLANGEAPTLTTADSEQQPSPHVFSLLARQGLAKFEEDSGAQPDDITR
TPPVYPCSRSSRLQQLMRGDEGYLLALAYSTQRGYGRNHPFAGEIRSGYIDVSIVPEELG
FAVNVGELLMTECEMVNGFIDPPGEPPHFTRGYGLVFGMSERKAMAMALVDRALQAPEYG
EHATGPAQDEEFVLAHADNVEAAGFVSHLKLPHYVDFQAELELLKRLQQEQNHG