Protein Info for b4081 in Escherichia coli BW25113

Name: yjcQ
Annotation: putative enzyme (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 transmembrane" amino acids 36 to 64 (29 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 152 to 178 (27 residues), see Phobius details amino acids 353 to 369 (17 residues), see Phobius details amino acids 375 to 391 (17 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details amino acids 426 to 445 (20 residues), see Phobius details amino acids 452 to 473 (22 residues), see Phobius details amino acids 483 to 502 (20 residues), see Phobius details PF04632: FUSC" amino acids 170 to 628 (459 residues), 52.9 bits, see alignment E=2.6e-18 PF13515: FUSC_2" amino acids 364 to 495 (132 residues), 33 bits, see alignment E=6.1e-12

Best Hits

Swiss-Prot: 100% identical to MDTO_ECOLI: Multidrug resistance protein MdtO (mdtO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4081)

MetaCyc: 100% identical to putative multidrug efflux pump subunit MdtO (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-351

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32715 at UniProt or InterPro

Protein Sequence (683 amino acids)

>b4081 putative enzyme (VIMSS) (Escherichia coli BW25113)
MSALNSLPLPVVRLLAFFHEELSERRPGRVPQTVQLWVGCLLVILISMTFEIPFVALSLA
VLFYGIQSNAFYTKFVAILFVVATVLEIGSLFLIYKWSYGEPLIRLIIAGPILMGCMFLM
RTHRLGLVFFAVAIVAIYGQTFPAMLDYPEVVVRLTLWCIVVGLYPTLLMTLIGVLWFPS
RAISQMHQALNDRLDDAISHLTDSLAPLPETRIEREALALQKLNVFCLADDANWRTQNAW
WQSCVATVTYIYSTLNRYDPTSFADSQAIIEFRQKLASEINKLQHAVAEGQCWQSDWRIS
ESEAMAARECNLENICQTLLQLGQMDPNTPPTPAAKPPSMAADAFTNPDYMRYAVKTLLA
CLICYTFYSGVDWEGIHTCMLTCVIVANPNVGSSYQKMVLRFGGAFCGAILALLFTLLVM
PWLDNIVELLFVLAPIFLLGAWIATSSERSSYIGTQMVVTFALATLENVFGPVYDLVEIR
DRALGIIIGTVVSAVIYTFVWPESEARTLPQKLAGTLGMLSKVMRIPRQQEVTALRTYLQ
IRIGLHAAFNACEEMCQRVALERQLDSEERALLIERSQTVIRQGRDLLHAWDATWNSAQA
LDNALQPDRAGQFADALEKYAAGLATALSRSPQITLEETPASQAILPTLLKQEQHVCQLF
ARLPDWTAPALTPATEQAQGATQ