Protein Info for b4075 in Escherichia coli BW25113

Name: nrfF
Annotation: heme lyase (NrfEFG) for insertion of heme into c552, subunit NrfF (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 103 to 122 (20 residues), see Phobius details TIGR03147: cytochrome c nitrite reductase, accessory protein NrfF" amino acids 3 to 127 (125 residues), 207.9 bits, see alignment E=1.6e-66 PF03918: CcmH" amino acids 8 to 126 (119 residues), 146.7 bits, see alignment E=1.4e-47

Best Hits

Swiss-Prot: 100% identical to NRFF_ECOLI: Formate-dependent nitrite reductase complex subunit NrfF (nrfF) from Escherichia coli (strain K12)

KEGG orthology group: K04017, formate-dependent nitrite reductase complex NrfF subunit (inferred from 100% identity to eco:b4075)

Predicted SEED Role

"Cytochrome c-type heme lyase subunit nrfF, nitrite reductase complex assembly" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32711 at UniProt or InterPro

Protein Sequence (127 amino acids)

>b4075 heme lyase (NrfEFG) for insertion of heme into c552, subunit NrfF (NCBI) (Escherichia coli BW25113)
MNKGLLTLLLLFTCFAHAQVVDTWQFANPQQQQQALNIASQLRCPQCQNQNLLESNAPVA
VSMRHQVYSMVAEGKNEVEIIGWMTERYGDFVRYNPPLTGQTLVLWALPVVLLLLMALIL
WRVRAKR