Protein Info for b4074 in Escherichia coli BW25113

Name: nrfE
Annotation: heme lyase (NrfEFG) for insertion of heme into c552, subunit NrfE (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 21 to 52 (32 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 232 to 248 (17 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 333 to 357 (25 residues), see Phobius details amino acids 376 to 394 (19 residues), see Phobius details amino acids 401 to 422 (22 residues), see Phobius details amino acids 527 to 545 (19 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 36 to 390 (355 residues), 615.6 bits, see alignment E=5.8e-189 PF01578: Cytochrom_C_asm" amino acids 72 to 278 (207 residues), 171 bits, see alignment E=2.9e-54 PF16327: CcmF_C" amino acids 301 to 403 (103 residues), 76.5 bits, see alignment E=2.5e-25 amino acids 403 to 543 (141 residues), 123.5 bits, see alignment E=1.2e-39

Best Hits

Swiss-Prot: 100% identical to NRFE_ECOLI: Probable cytochrome c-type biogenesis protein NrfE (nrfE) from Escherichia coli (strain K12)

KEGG orthology group: K04016, formate-dependent nitrite reductase, possible assembly protein (inferred from 100% identity to eco:b4074)

Predicted SEED Role

"Cytochrome c-type heme lyase subunit nrfE, nitrite reductase complex assembly" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32710 at UniProt or InterPro

Protein Sequence (552 amino acids)

>b4074 heme lyase (NrfEFG) for insertion of heme into c552, subunit NrfE (NCBI) (Escherichia coli BW25113)
MLTPLTAFAGVRLRWPAMMRLTCIGILAQFALLLLAFGVLTYCFLISDFSVIYVAQHSYS
LLSWELKLAAVWGGHEGSLLLWVLLLSAWSALFAWHYRQQTDPLFPLTLAVLSLMLAALL
LFVVLWSDPFVRIFPPAIEGRDLNPMLQHPGLIFHPPLLYLGYGGLMVAASVALASLLRG
EFDGACARICWRWALPGWSALTAGIILGSWWAYCELGWGGWWFWDPVENASLLPWLSATA
LLHSLSLTRQRGIFCHWSLLLAIVTLMLSLLGTLIVRSGILVSVHAFALDNVRAVPLFSL
FALISLASLALYGWRARDGGPAVHFSGLSREMLILATLLLFCAVLLIVLVGTLYPMIYGL
LGWGRLSVGAPYFNRATLPFGLLMLVVIVLATFVSGKRVQLPALVAHAGVLLFAAGVVVS
SVSRQEISLNLQPGQQVTLAGYTFRFECLDLQAKGNYTSEKAIVALFDHQQRIGELTPER
RFYEARRQQMMEPSIRWNGIHDWYAVMGEKTGPDRYAFRLYVQSGVRWIWGGGLLMIAGA
LLSGWRGKKRDE