Protein Info for b4072 in Escherichia coli BW25113

Name: nrfC
Annotation: formate-dependent nitrite reductase, 4Fe4S subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR03149: cytochrome c nitrite reductase, Fe-S protein" amino acids 2 to 222 (221 residues), 418.6 bits, see alignment E=5e-130 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 3 to 26 (24 residues), 17.8 bits, see alignment (E = 3.2e-07) PF00037: Fer4" amino acids 40 to 56 (17 residues), 21.2 bits, see alignment (E = 9.1e-08) amino acids 119 to 138 (20 residues), 26.1 bits, see alignment (E = 2.5e-09) PF12800: Fer4_4" amino acids 44 to 57 (14 residues), 14.8 bits, see alignment (E = 1.4e-05) amino acids 122 to 137 (16 residues), 16.2 bits, see alignment (E = 5e-06) PF12838: Fer4_7" amino acids 46 to 108 (63 residues), 30.6 bits, see alignment E=1.8e-10 PF13247: Fer4_11" amino acids 83 to 181 (99 residues), 83.1 bits, see alignment E=6.3e-27 PF13237: Fer4_10" amino acids 89 to 136 (48 residues), 25.5 bits, see alignment 4.5e-09 amino acids 120 to 173 (54 residues), 26.1 bits, see alignment E=3.1e-09

Best Hits

Swiss-Prot: 100% identical to NRFC_ECO57: Protein NrfC (nrfC) from Escherichia coli O157:H7

KEGG orthology group: K04014, formate-dependent nitrite reductase, Fe-S protein (inferred from 100% identity to eco:b4072)

MetaCyc: 55% identical to polysulfide reductase beta subunit (Wolinella succinogenes)
RXN-8269 [EC: 1.12.98.4]

Predicted SEED Role

"NrfC protein" in subsystem Nitrate and nitrite ammonification

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AAK7 at UniProt or InterPro

Protein Sequence (223 amino acids)

>b4072 formate-dependent nitrite reductase, 4Fe4S subunit (NCBI) (Escherichia coli BW25113)
MTWSRRQFLTGVGVLAAVSGTAGRVVAKTLNINGVRYGMVHDESLCIGCTACMDACREVN
KVPEGVSRLTIIRSEPQGEFPDVKYRFFRKSCQHCDHAPCVDVCPTGASFRDAASGIVDV
NPDLCVGCQYCIAACPYRVRFIHPVTKTADKCDFCRKTNLQAGKLPACVEACPTKALTFG
NLDDPNSEISQLLRQKPTYRYKLALGTKPKLYRVPFKYGEVSQ