Protein Info for b4071 in Escherichia coli BW25113

Name: nrfB
Annotation: formate-dependent nitrite reductase; a penta-haeme cytochrome c (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR03146: cytochrome c nitrite reductase, pentaheme subunit" amino acids 36 to 171 (136 residues), 198.6 bits, see alignment E=2.8e-63 PF13435: Cytochrome_C554" amino acids 36 to 83 (48 residues), 15.8 bits, see alignment E=5.6e-06 amino acids 107 to 143 (37 residues), 15.5 bits, see alignment 7.2e-06

Best Hits

Swiss-Prot: 100% identical to NRFB_ECOLI: Cytochrome c-type protein NrfB (nrfB) from Escherichia coli (strain K12)

KEGG orthology group: K04013, formate-dependent nitrite reductase, penta-haeme cytochrome c (inferred from 100% identity to eco:b4071)

MetaCyc: 100% identical to periplasmic nitrite reductase penta-heme c-type cytochrome (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cytochrome c-type protein NrfB precursor" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ABL1 at UniProt or InterPro

Protein Sequence (188 amino acids)

>b4071 formate-dependent nitrite reductase; a penta-haeme cytochrome c (VIMSS) (Escherichia coli BW25113)
MSVLRSLLTAGVLASGLLWSLNGITATPAAQASDDRYEVTQQRNPDAACLDCHKPDTEGM
HGKHASVINPNNKLPVTCTNCHGQPSPQHREGVKDVMRFNEPMYKVGEQNSVCMSCHLPE
QLQKAFWPHDVHVTKVACASCHSLHPQQDTMQTLSDKGRIKICVDCHSDQRTNPNFNPAS
VPLLKEQP