Protein Info for b4066 in Escherichia coli BW25113

Name: yjcF
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF00805: Pentapeptide" amino acids 163 to 197 (35 residues), 27 bits, see alignment 4e-10 amino acids 268 to 304 (37 residues), 30.3 bits, see alignment 3.7e-11 amino acids 309 to 345 (37 residues), 18.3 bits, see alignment 2.1e-07 PF13599: Pentapeptide_4" amino acids 197 to 259 (63 residues), 28.4 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 100% identical to YJCF_ECOLI: Uncharacterized protein YjcF (yjcF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4066)

Predicted SEED Role

"FIG00638091: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32704 at UniProt or InterPro

Protein Sequence (430 amino acids)

>b4066 hypothetical protein (NCBI) (Escherichia coli BW25113)
MRYNGLNNMFFPLCLINDNHSVTSPSHTKKTKSDNYSKHHKNTLIDNKALSLFKMDDHEK
VIGLIQKMKRIYDSLPSGKITKETDRKIHKYFIDIASHANNKCDDRITRRVYLNKDKEVS
IKVVYFINNVTVHNNTIEIPQTVNGGYDFSHLSLKGIVIKDEDLSNSNFAGCRLQNAIFQ
DCNMYKTNFNFAIMEKILFDNCILDDSNFAQIKMTDGTLNSCSAMHVQFYNATMNRANIK
NTFLDYSNFYMAYMAEVNLYKVIAPYINLFRADLSFSKLDLINFEHADLSRVNLNKATLQ
NINLIDSKLFFTRLTNTFLEMVICTDSNMANVNFNNANLSNCHFNCSVLTKAWMFNIRLY
RVNFDEASVQGMGITILRGEENISINSDILVTLQKFFEEDCATHTGMSQTEDNLHAVAMK
ITADIMQDAD