Protein Info for b4031 in Escherichia coli BW25113

Name: xylE
Annotation: D-xylose transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details amino acids 27 to 31 (5 residues), see Phobius details transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 270 to 297 (28 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 370 to 395 (26 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details amino acids 445 to 463 (19 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 1 to 474 (474 residues), 544.7 bits, see alignment E=1e-167 PF00083: Sugar_tr" amino acids 14 to 478 (465 residues), 471.4 bits, see alignment E=3.2e-145 PF07690: MFS_1" amino acids 29 to 418 (390 residues), 85.2 bits, see alignment E=4.2e-28 amino acids 283 to 477 (195 residues), 40.2 bits, see alignment E=2.1e-14

Best Hits

Swiss-Prot: 100% identical to XYLE_ECOLI: D-xylose-proton symporter (xylE) from Escherichia coli (strain K12)

KEGG orthology group: K08138, MFS transporter, SP family, xylose:H+ symportor (inferred from 100% identity to eco:b4031)

MetaCyc: 100% identical to D-xylose:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-30

Predicted SEED Role

"D-xylose proton-symporter XylE" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AGF4 at UniProt or InterPro

Protein Sequence (491 amino acids)

>b4031 D-xylose transporter (NCBI) (Escherichia coli BW25113)
MNTQYNSSYIFSITLVATLGGLLFGYDTAVISGTVESLNTVFVAPQNLSESAANSLLGFC
VASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAWPELGFTSINPDNTVPV
YLAGYVPEFVIYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYC
VNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTVPESPRWLMSRGKQEQAEGIL
RKIMGNTLATQAVQEIKHSLDHGRKTGGRLLMFGVGVIVIGVMLSIFQQFVGINVVLYYA
PEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRKPLQIIGALGMAIGMFSLG
TAFYTQAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKALAIAVAAQWLANY
FVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKTLEELEALWEP
ETKKTQQTATL