Protein Info for b4029 in Escherichia coli BW25113

Name: yjbH
Annotation: predicted porin (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 698 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF06082: YjbH" amino acids 30 to 691 (662 residues), 900.1 bits, see alignment E=5.9e-275

Best Hits

Swiss-Prot: 100% identical to YJBH_ECOLI: Uncharacterized lipoprotein YjbH (yjbH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4029)

Predicted SEED Role

"YjbH outer membrane lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32689 at UniProt or InterPro

Protein Sequence (698 amino acids)

>b4029 predicted porin (NCBI) (Escherichia coli BW25113)
MKKRHLLSLLALGISTACYGETYPAPIGPSQSDFGGVGLLQTPTARMAREGELSLNYRDN
DQYRYYSASVQLFPWLETTLRYTDVRTRQYSSVEAFSGDQTYKDKAFDLKLRLWEESYWL
PQVAVGARDIGGTGLFDAEYLVASKAWGPFDFTLGLGWGYLGTSGNVKNPLCSASDKYCY
RDNSYKQAGSIDGSQMFHGPASLFGGVEYQTPWQPLRLKLEYEGNNYQQDFAGKLEQKSK
FNVGAIYRVTDWADVNLSYERGNTFMFGVTLRTNFNDLRPSYNDNARPQYQPQPQDAILQ
HSVVANQLTLLKYNAGLADPQIQAKGDTLYVTGEQVKYRDSREGIIRANRIVMNDLPDGI
KTIRITENRLNMPQVTTETDVASLKNHLAGEPLGHETTLAQKRVEPVVPQSTEQGWYIDK
SRFDFHIDPVLNQSVGGPENFYMYQLGVMGTADLWLTDHLLTTGSLFANLANNYDKFNYT
NPPQDSHLPRVRTHVREYVQNDVYVNNLQANYFQHLGNGFYGQVYGGYLETMFGGAGAEV
LYRPLDSNWAFGLDANYVKQRDWRSAKDMMKFTDYSVKTGHLTAYWTPSFAQDVLVKASV
GQYLAGDKGGTLEIAKRFDSGVVVGGYATITNVSKEEYGEGDFTKGVYVSVPLDLFSSGP
TRSRAAIGWTPLTRDGGQQLGRKFQLYDMTSDRSVNFR