Protein Info for b4020 in Escherichia coli BW25113

Name: yjbB
Annotation: predicted transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 45 to 69 (25 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 163 to 223 (61 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details TIGR00704: Na/Pi-cotransporter II-related protein" amino acids 1 to 308 (308 residues), 455.6 bits, see alignment E=1.1e-140 PF02690: Na_Pi_cotrans" amino acids 13 to 147 (135 residues), 124.2 bits, see alignment E=4.1e-40 TIGR01013: sodium-dependent inorganic phosphate (Pi) transporter" amino acids 67 to 520 (454 residues), 568.3 bits, see alignment E=1.3e-174

Best Hits

Swiss-Prot: 100% identical to YJBB_SHIFL: Uncharacterized protein YjbB (yjbB) from Shigella flexneri

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 100% identity to eco:b4020)

MetaCyc: 100% identical to putative inorganic phosphate export protein YjbB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-470

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AF43 at UniProt or InterPro

Protein Sequence (543 amino acids)

>b4020 predicted transporter (NCBI) (Escherichia coli BW25113)
MLTLLHLLSAVALLVWGTHIVRTGVMRVFGARLRTVLSRSVEKKPLAFCAGIGVTALVQS
SNATTMLVTSFVAQDLVALAPALVIVLGADVGTALMARILTFDLSWLSPLLIFIGVIFFL
GRKQSRAGQLGRVGIGLGLILLALELIVQAVTPITQANGVQVIFASLTGDILLDALIGAM
FAIISYSSLAAVLLTATLTAAGIISFPVALCLVIGANLGSGLLAMLNNSAANAAARRVAL
GSLLFKLVGSLIILPFVHLLAETMGKLSLPKAELVIYFHVFYNLVRCLVMLPFVDPMARF
CKTIIRDEPELDTQLRPKHLDVSALDTPTLALANAARETLRIGDAMEQMMEGLNKVMHGE
PRQEKELRKLADDINVLYTAIKLYLARMPKEELAEEESRRWAEIIEMSLNLEQASDIVER
MGSEIADKSLAARRAFSLDGLKELDALYEQLLSNLKLAMSVFFSGDVTSARRLRRSKHRF
RILNRRYSHAHVDRLHQQNVQSIETSSLHLGLLGDMQRLNSLFCSVAYSVLEQPDEDEGR
DEY