Protein Info for b4005 in Escherichia coli BW25113

Name: purD
Annotation: phosphoribosylamine--glycine ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02844: GARS_N
  • amino acids 1 to 102 (102 residues), 135.3 bits, E=3e-43
• TIGR00877: phosphoribosylamine--glycine ligase
  • amino acids 1 to 425 (425 residues), 630.8 bits, E=5.2e-194
• PF01071: GARS_A
  • amino acids 103 to 296 (194 residues), 282.1 bits, E=6.1e-88
• PF02655: ATP-grasp_3
  • amino acids 104 to 291 (188 residues), 26.2 bits, E=1.9e-09
• PF02786: CPSase_L_D2
  • amino acids 109 to 245 (137 residues), 23.6 bits, E=8.5e-09
• PF02843: GARS_C
  • amino acids 332 to 422 (91 residues), 113.7 bits, E=9.8e-37

Best Hits

Swiss-Prot: 100% identical to PUR2_ECOLI: Phosphoribosylamine--glycine ligase (purD) from Escherichia coli (strain K12)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 100% identity to eco:b4005)

MetaCyc: 100% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

See P15640 at UniProt or InterPro

Protein Sequence (429 amino acids)

>b4005 phosphoribosylamine--glycine ligase (NCBI) (Escherichia coli BW25113)
MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA
QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA
EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA
GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT
DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM
LRMKSDLVELCLAACESKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA
GGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG
WRAIEREQN