Protein Info for b4004 in Escherichia coli BW25113

Name: zraR
Annotation: fused DNA-binding response regulator in two-component regulatory system with ZraS: response regulator/sigma54 interaction protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF00072: Response_reg" amino acids 8 to 117 (110 residues), 110.1 bits, see alignment E=2.3e-35 PF00158: Sigma54_activat" amino acids 141 to 308 (168 residues), 245.3 bits, see alignment E=9.6e-77 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 68.6 bits, see alignment E=2.4e-22 PF07728: AAA_5" amino acids 165 to 283 (119 residues), 31.4 bits, see alignment E=6.1e-11 PF25601: AAA_lid_14" amino acids 313 to 389 (77 residues), 99.7 bits, see alignment E=2.4e-32 PF02954: HTH_8" amino acids 403 to 440 (38 residues), 55.6 bits, see alignment 1.2e-18

Best Hits

Swiss-Prot: 100% identical to ZRAR_ECOLI: Transcriptional regulatory protein ZraR (zraR) from Escherichia coli (strain K12)

KEGG orthology group: K07713, two-component system, NtrC family, response regulator HydG (inferred from 100% identity to eco:b4004)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P14375 at UniProt or InterPro

Protein Sequence (441 amino acids)

>b4004 fused DNA-binding response regulator in two-component regulatory system with ZraS: response regulator/sigma54 interaction protein (NCBI) (Escherichia coli BW25113)
MTHDNIDILVVDDDISHCTILQALLRGWGYNVALANSGRQALEQVREQVFDLVLCDVRMA
EMDGIATLKEIKALNPAIPVLIMTAYSSVETAVEALKTGALDYLIKPLDFDNLQATLEKA
LAHTHSIDAETPAVTASQFGMVGKSPAMQHLLSEIALVAPSEATVLIHGDSGTGKELVAR
AIHASSARSEKPLVTLNCAALNESLLESELFGHEKGAFTGADKRREGRFVEADGGTLFLD
EIGDISPMMQVRLLRAIQEREVQRVGSNQIISVDVRLIAATHRDLAAEVNAGRFRQDLYY
RLNVVAIEVPSLRQRREDIPLLAGHFLQRFAERNRKAVKGFTPQAMDLLIHYDWPGNIRE
LENAVERAVVLLTGEYISERELPLAIASTPIPLGQSQDIQPLVEVEKEVILAALEKTGGN
KTEAARQLGITRKTLLAKLSR