Protein Info for b4003 in Escherichia coli BW25113

Name: zraS
Annotation: sensory histidine kinase in two-component regulatory system with ZraR (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details PF00512: HisKA" amino acids 245 to 307 (63 residues), 52 bits, see alignment E=8.9e-18 PF02518: HATPase_c" amino acids 353 to 457 (105 residues), 103.2 bits, see alignment E=1.7e-33 PF14501: HATPase_c_5" amino acids 357 to 444 (88 residues), 22.4 bits, see alignment E=1.5e-08

Best Hits

Swiss-Prot: 100% identical to ZRAS_ECOLI: Sensor protein ZraS (zraS) from Escherichia coli (strain K12)

KEGG orthology group: K07709, two-component system, NtrC family, sensor histidine kinase HydH [EC: 2.7.13.3] (inferred from 100% identity to eco:b4003)

MetaCyc: 100% identical to sensor histidine kinase ZraS (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensor protein of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P14377 at UniProt or InterPro

Protein Sequence (465 amino acids)

>b4003 sensory histidine kinase in two-component regulatory system with ZraR (NCBI) (Escherichia coli BW25113)
MRFMQRSKDSLAKWLSAILPVVIVGLVGLFAVTVIRDYGRASEADRQALLEKGNVLIRAL
ESGSRVGMGMRMHHVQQQALLEEMAGQPGVLWFAVTDAQGIIILHSDPDKVGRALYSPDE
MQKLKPEENSRWRLLGKTETTPALEVYRLFQPMSAPWRHGMHNMPRCNGKAVPQVDAQQA
IFIAVDASDLVATQSGEKRNTLIILFALATVLLASVLSFFWYRRYLRSRQLLQDEMKRKE
KLVALGHLAAGVAHEIRNPLSSIKGLAKYFAERAPAGGEAHQLAQVMAKEADRLNRVVSE
LLELVKPTHLALQAVDLNTLINHSLQLVSQDANSREIQLRFTANDTLPEIQADPDRLTQV
LLNLYLNAIQAIGQHGVISVTASESGAGVKISVTDSGKGIAADQLDAIFTPYFTTKAEGT
GLGLAVVHNIVEQHGGTIQVASQEGKGSTFTLWLPVNITRKDPQG