Protein Info for b3950 in Escherichia coli BW25113

Name: frwB
Annotation: predicted enzyme IIB component of PTS (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00829: PTS system, Fru family, IIB component
  • amino acids 5 to 89 (85 residues), 137.5 bits, E=7.4e-45
• PF02302: PTS_IIB
  • amino acids 6 to 96 (91 residues), 82.8 bits, E=1.1e-27

Best Hits

Swiss-Prot: 100% identical to PTFB2_ECOLI: PTS system fructose-like EIIB component 2 (frwB) from Escherichia coli (strain K12)

KEGG orthology group: K11202, PTS system, fructose-specific IIB-like component [EC: 2.7.1.69] (inferred from 100% identity to eco:b3950)

MetaCyc: 100% identical to putative PTS enzyme IIB component FrwB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system fructose-like IIB component 1 precursor (EC 2.7.1.69)" (EC 2.7.1.69)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

See P69816 at UniProt or InterPro

Protein Sequence (106 amino acids)

>b3950 predicted enzyme IIB component of PTS (NCBI) (Escherichia coli BW25113)
MTKIIAVTACPSGVAHTYMAAEALESAAKAKGWEVKVETQGSIGLENELTAEDVASADMV
ILTKDIGIKFEERFAGKTIVRVNISDAVKRADAIMSKIEAHLAQTA