Protein Info for b3929 in Escherichia coli BW25113

Name: rraA
Annotation: ribonuclease activity regulator protein RraA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 TIGR02998: regulator of ribonuclease activity A" amino acids 1 to 161 (161 residues), 297.3 bits, see alignment E=2.9e-93 TIGR01935: RraA family" amino acids 5 to 154 (150 residues), 208.4 bits, see alignment E=4.6e-66 PF03737: RraA-like" amino acids 5 to 152 (148 residues), 136.4 bits, see alignment E=4.7e-44

Best Hits

Swiss-Prot: 100% identical to RRAA_ECOL6: Regulator of ribonuclease activity A (rraA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02553, regulator of ribonuclease activity A (inferred from 100% identity to eco:b3929)

Predicted SEED Role

"Ribonuclease E inhibitor RraA" in subsystem RNA processing and degradation, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A8R0 at UniProt or InterPro

Protein Sequence (161 amino acids)

>b3929 ribonuclease activity regulator protein RraA (NCBI) (Escherichia coli BW25113)
MKYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRV
LVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAA
GEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE