Protein Info for b3899 in Escherichia coli BW25113

Name: frvB
Annotation: PTS system, fructose-like enzyme IIBC component (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 132 to 160 (29 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 205 to 222 (18 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 443 to 466 (24 residues), see Phobius details PF25554: PTS_EIIB_BC_N" amino acids 6 to 102 (97 residues), 34.1 bits, see alignment E=3.8e-12 TIGR00829: PTS system, Fru family, IIB component" amino acids 8 to 94 (87 residues), 102 bits, see alignment E=1.7e-33 PF02302: PTS_IIB" amino acids 9 to 101 (93 residues), 73.2 bits, see alignment E=3.4e-24 TIGR01427: PTS system, Fru family, IIC component" amino acids 124 to 452 (329 residues), 195.5 bits, see alignment E=1.6e-61 PF02378: PTS_EIIC" amino acids 134 to 406 (273 residues), 118 bits, see alignment E=7.3e-38

Best Hits

Swiss-Prot: 100% identical to PTFLB_ECOLI: Fructose-like PTS system EIIBC component (frvB) from Escherichia coli (strain K12)

KEGG orthology group: K11202, PTS system, fructose-specific IIB-like component [EC: 2.7.1.69] K11203, PTS system, fructose-specific IIC-like component (inferred from 100% identity to eco:b3899)

MetaCyc: 100% identical to putative PTS enzyme IIBC component FrvB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69)" in subsystem Fructose utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32154 at UniProt or InterPro

Protein Sequence (483 amino acids)

>b3899 PTS system, fructose-like enzyme IIBC component (VIMSS) (Escherichia coli BW25113)
MESSLRIVAITNCPAGIAHTYMVAEALEQKARSLGHTIKVETQGSSGVENRLSSEEIAAA
DYVILATGRGLSGDDRARFAGKKVYEIAISQALKNIDQIFSELPTNSQLFAADSGVKLGK
QEVQSGSVMSHLMAGVSAALPFVIGGGILVALANMLVQFGLPYTDMSKGAPSFTWVVESI
GYLGFTFMIPIMGAYIASSIADKPAFAPAFLVCYLANDKALLGTQSGAGFLGAVVLGLAI
GYFVFWFRKVRLGKALQPLLGSMLIPFVTLLVFGVLTYYVIGPVMSDLMGGLLHFLNTIP
PSMKFAAAFLVGAMLAFDMGGPINKTAWFFCFSLLEKHIYDWYAIVGVVALMPPVAAGLA
TFIAPKLFTRQEKEAASSAIVVGATVATEPAIPYALAAPLPMITANTLAGGITGVLVIAF
GIKRLAPGLGIFDPLIGLMSPVGSFYLVLAIGLALNISFIIVLKGLWLRRKAKAAQQELV
HEH