Protein Info for b3882 in Escherichia coli BW25113

Name: yihU
Annotation: predicted oxidoreductase with NAD(P)-binding Rossmann-fold domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03446: NAD_binding_2
  • amino acids 4 to 160 (157 residues), 165.8 bits, E=1.3e-52
• PF03807: F420_oxidored
  • amino acids 4 to 69 (66 residues), 32.5 bits, E=1.6e-11
• PF14833: NAD_binding_11
  • amino acids 165 to 284 (120 residues), 87.9 bits, E=9.2e-29

Best Hits

Swiss-Prot: 100% identical to SQUU_ECOLI: 3-sulfolactaldehyde reductase (yihU) from Escherichia coli (strain K12)

KEGG orthology group: K08318, putative dehydrogenase [EC: 1.1.-.-] (inferred from 100% identity to eco:b3882)

MetaCyc: 100% identical to 3-sulfolactaldehyde reductase (Escherichia coli K-12 substr. MG1655)
4-hydroxybutyrate dehydrogenase. [EC: 1.1.1.61]; RXN-15299 [EC: 1.1.1.61, 1.1.1.373]

Predicted SEED Role

No annotation

MetaCyc Pathways

• sulfoquinovose degradation I (4/5 steps found)
• 4-aminobutanoate degradation V (3/7 steps found)
• succinate fermentation to butanoate (2/7 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Bisphenol A degradation
• Butanoate metabolism
• Ethylbenzene degradation
• Limonene and pinene degradation
• Naphthalene and anthracene degradation
• Retinol metabolism
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.-.-

Use Curated BLAST to search for 1.1.-.- or 1.1.1.373 or 1.1.1.61

Sequence Analysis Tools

See P0A9V8 at UniProt or InterPro

Protein Sequence (298 amino acids)

>b3882 predicted oxidoreductase with NAD(P)-binding Rossmann-fold domain (NCBI) (Escherichia coli BW25113)
MAAIAFIGLGQMGSPMASNLLQQGHQLRVFDVNAEAVRHLVDKGATPAANPAQAAKDAEF
IITMLPNGDLVRNVLFGENGVCEGLSTDALVIDMSTIHPLQTDKLIADMQAKGFSMMDVP
VGRTSANAITGTLLLLAGGTAEQVERATPILMAMGSELINAGGPGMGIRVKLINNYMSIA
LNALSAEAAVLCEALNLPFDVAVKVMSGTAAGKGHFTTSWPNKVLSGDLSPAFMIDLAHK
DLGIALDVANQLHVPMPLGAASREVYSQARAAGRGRQDWSAILEQVRVSAGMTAKVKM