Protein Info for b3881 in Escherichia coli BW25113

Name: yihT
Annotation: predicted aldolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01791: DeoC
  • amino acids 17 to 257 (241 residues), 195.5 bits, E=5.4e-62

Best Hits

Swiss-Prot: 100% identical to SQUT_ECOLI: Sulfofructosephosphate aldolase (yihT) from Escherichia coli (strain K12)

KEGG orthology group: K01671, [EC: 4.1.-.-] (inferred from 100% identity to eco:b3881)

MetaCyc: 100% identical to 6-deoxy-6-sulfofructose-1-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
RXN-15298 [EC: 4.1.2.57]

Predicted SEED Role

"Aldolase YihT"

MetaCyc Pathways

• sulfoquinovose degradation I (4/5 steps found)
• sulfoquinovose degradation VI (3/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.-.- or 4.1.2.57

Sequence Analysis Tools

See P32141 at UniProt or InterPro

Protein Sequence (292 amino acids)

>b3881 predicted aldolase (NCBI) (Escherichia coli BW25113)
MNKYTINDITRASGGFAMLAVDQREAMRMMFAAAGAPAPVADSVLTDFKVNAAKALSPYA
SAILVDQQFCYRQVVEQNAIAKSCAMIVAADEFIPGNGIPVDSVVIDRKINPLQIKQDGG
KALKLLVLWRSDEDAQQRLDMVKEFNELCHSHGLVSIIEPVVRPPRRGDKFDREQAIIDA
AKELGDSGADLYKVEMPLYGKGPQQELLCASQRLNDHINMPWVILSSGVDEKLFPRAVRV
AMTAGASGFLAGRAVWASVVGLPDNELMLRDVCAPKLQQLGDIVDEMMAKRR