Protein Info for b3870 in Escherichia coli BW25113

Name: glnA
Annotation: glutamine synthetase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00653: glutamine synthetase, type I
  • amino acids 4 to 468 (465 residues), 731.9 bits, E=1.4e-224
• PF03951: Gln-synt_N
  • amino acids 14 to 95 (82 residues), 114.4 bits, E=1.5e-37
• PF00120: Gln-synt_C
  • amino acids 103 to 466 (364 residues), 479 bits, E=8.5e-148

Best Hits

Swiss-Prot: 100% identical to GLN1B_ECO57: Glutamine synthetase (glnA) from Escherichia coli O157:H7

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 100% identity to eco:b3870)

MetaCyc: 100% identical to glutamine synthetase (Escherichia coli K-12 substr. MG1655)
Glutamate--ammonia ligase. [EC: 6.3.1.2]

Predicted SEED Role

"Glutamine synthetase type I (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-aspartate degradation II (aerobic) (3/3 steps found)
• L-aspartate degradation III (anaerobic) (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• L-glutamine biosynthesis I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of ammonia assimilation (plants) (2/3 steps found)
• ammonia assimilation cycle II (1/2 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.2

Sequence Analysis Tools

See P0A9C5 at UniProt or InterPro

Protein Sequence (469 amino acids)

>b3870 glutamine synthetase (NCBI) (Escherichia coli BW25113)
MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGKMFDGSSIGGWKG
INESDMVLMPDASTAVIDPFFADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRSTG
IADTVLFGPEPEFFLFDDIRFGSSISGSHVAIDDIEGAWNSSTQYEGGNKGHRPAVKGGY
FPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYK
YVVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLSKNGVNLFAGDKYAGLSEQALYYIG
GVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRSASIRIPVVSSPKARRIEVR
FPDPAANPYLCFAALLMAGLDGIKNKIHPGEAMDKNLYDLPPEEAKEIPQVAGSLEEALN
ELDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV