Protein Info for b3857 in Escherichia coli BW25113

Name: mobA
Annotation: molybdopterin-guanine dinucleotide biosynthesis protein A (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR02665: molybdenum cofactor guanylyltransferase" amino acids 7 to 188 (182 residues), 230.5 bits, see alignment E=8.2e-73 PF12804: NTP_transf_3" amino acids 9 to 158 (150 residues), 134.8 bits, see alignment E=1.6e-43

Best Hits

Swiss-Prot: 100% identical to MOBA_ECOLI: Molybdenum cofactor guanylyltransferase (mobA) from Escherichia coli (strain K12)

KEGG orthology group: K03752, molybdopterin-guanine dinucleotide biosynthesis protein A (inferred from 100% identity to eco:b3857)

MetaCyc: 100% identical to molybdenum cofactor guanylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-21601 [EC: 2.7.7.77]; 2.7.7.77 [EC: 2.7.7.77]

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32173 at UniProt or InterPro

Protein Sequence (194 amino acids)

>b3857 molybdopterin-guanine dinucleotide biosynthesis protein A (NCBI) (Escherichia coli BW25113)
MNLMTTITGVVLAGGKARRMGGVDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEI
YQASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDA
PVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDFSDHKDAFVN
VNTPEELARWQEKR