Protein Info for b3843 in Escherichia coli BW25113

Name: ubiD
Annotation: 3-octaprenyl-4-hydroxybenzoate decarboxylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 9 to 458 (450 residues), 634.6 bits, E=3.8e-195
• PF20695: UbiD_N
  • amino acids 13 to 92 (80 residues), 103.1 bits, E=1e-33
• PF01977: UbiD
  • amino acids 127 to 325 (199 residues), 283.1 bits, E=1.4e-88
• PF20696: UbiD_C
  • amino acids 331 to 455 (125 residues), 159.8 bits, E=4.7e-51

Best Hits

Swiss-Prot: 100% identical to UBID_ECOL6: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 100% identity to eco:b3843)

MetaCyc: 100% identical to 3-octaprenyl-4-hydroxybenzoate decarboxylase (Escherichia coli K-12 substr. MG1655)
3-OCTAPRENYL-4-OHBENZOATE-DECARBOX-RXN [EC: 4.1.1.98]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• plastoquinol-9 biosynthesis II (1/5 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.98

Sequence Analysis Tools

See P0AAB4 at UniProt or InterPro

Protein Sequence (497 amino acids)

>b3843 3-octaprenyl-4-hydroxybenzoate decarboxylase (NCBI) (Escherichia coli BW25113)
MDAMKYNDLRDFLTLLEQQGELKRITLPVDPHLEITEIADRTLRAGGPALLFENPKGYSM
PVLCNLFGTPKRVAMGMGQEDVSALREVGKLLAFLKEPEPPKGFRDLFDKLPQFKQVLNM
PTKRLRGAPCQQKIVSGDDVDLNRIPIMTCWPEDAAPLITWGLTVTRGPHKERQNLGIYR
QQLIGKNKLIMRWLSHRGGALDYQEWCAAHPGERFPVSVALGADPATILGAVTPVPDTLS
EYAFAGLLRGTKTEVVKCISNDLEVPASAEIVLEGYIEQGETAPEGPYGDHTGYYNEVDS
FPVFTVTHITQREDAIYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPEIVDFYLPPEG
CSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQFMYTKFVIVCDDDVNARDWNDVIWAITTR
MDPARDTVLVENTPIDYLDFASPVSGLGSKMGLDATNKWPGETQREWGRPIKKDPDVVAH
IDAIWDELAIFNNGKSA