Protein Info for b3828 in Escherichia coli BW25113

Name: metR
Annotation: DNA-binding transcriptional activator, homocysteine-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF00126: HTH_1" amino acids 5 to 63 (59 residues), 64.1 bits, see alignment E=9e-22 PF03466: LysR_substrate" amino acids 86 to 288 (203 residues), 163.7 bits, see alignment E=3.9e-52

Best Hits

Swiss-Prot: 100% identical to METR_ECOLI: HTH-type transcriptional regulator MetR (metR) from Escherichia coli (strain K12)

KEGG orthology group: K03576, LysR family transcriptional regulator, regulator for metE and metH (inferred from 100% identity to eco:b3828)

Predicted SEED Role

"Transcriptional activator MetR" in subsystem Methionine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A9F9 at UniProt or InterPro

Protein Sequence (317 amino acids)

>b3828 DNA-binding transcriptional activator, homocysteine-binding (NCBI) (Escherichia coli BW25113)
MIEVKHLKTLQALRNCGSLAAAAATLHQTQSALSHQFSDLEQRLGFRLFVRKSQPLRFTP
QGEILLQLANQVLPQISQALQACNEPQQTRLRIAIECHSCIQWLTPALENFHKNWPQVEM
DFKSGVTFDPQPALQQGELDLVMTSDILPRSGLHYSPMFDYEVRLVLAPDHPLAAKTRIT
PEDLASETLLIYPVQRSRLDVWRHFLQPAGVSPSLKSVDNTLLLIQMVAARMGIAALPHW
VVESFERQGLVVTKTLGEGLWSRLYAAVRDGEQRQPVTEAFIRSARNHACDHLPFVKSAE
RPTYDAPTVRPGSPARL