Protein Info for b3802 in Escherichia coli BW25113

Name: hemY
Annotation: predicted protoheme IX synthesis protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details TIGR00540: heme biosynthesis-associated TPR protein" amino acids 4 to 386 (383 residues), 392.4 bits, see alignment E=9.5e-122 PF07219: HemY_N" amino acids 26 to 132 (107 residues), 121.2 bits, see alignment E=4.2e-39 PF07719: TPR_2" amino acids 329 to 360 (32 residues), 25 bits, see alignment (E = 2.9e-09)

Best Hits

Swiss-Prot: 100% identical to HEMY_ECOL6: Protein HemY (hemY) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02498, HemY protein (inferred from 100% identity to eco:b3802)

Predicted SEED Role

"Uncharacterized protein EC-HemY, likely associated with heme metabolism based on gene clustering with hemC, hemD in Proteobacteria (unrelated to HemY-type PPO in GramPositives)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACB7 at UniProt or InterPro

Protein Sequence (398 amino acids)

>b3802 predicted protoheme IX synthesis protein (NCBI) (Escherichia coli BW25113)
MLKVLLLFVLLIAGIVVGPMIAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEW
LLRRIFRTGAHTRGWFVGRKRRRARKQTEQALLKLAEGDYQQVEKLMAKNADHAEQPVVN
YLLAAEAAQQRGDEARANQHLERAAELAGNDTIPVEITRVRLQLARNENHAARHGVDKLL
EVTPRHPEVLRLAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQAR
ADNGSEGLRNWWKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLL
PIPRLKTNNPEQLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPD
AYDYAWLADALDRLHKPEEAAAMRRDGLMLTLQNNPPQ