Protein Info for b3781 in Escherichia coli BW25113

Name: trxA
Annotation: thioredoxin 1 (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF00085: Thioredoxin" amino acids 5 to 105 (101 residues), 118 bits, see alignment E=1.7e-38 TIGR01068: thioredoxin" amino acids 9 to 107 (99 residues), 131.8 bits, see alignment E=4.6e-43 PF13098: Thioredoxin_2" amino acids 21 to 105 (85 residues), 33.6 bits, see alignment E=4.2e-12

Best Hits

Swiss-Prot: 100% identical to THIO_ECOLI: Thioredoxin 1 (trxA) from Escherichia coli (strain K12)

KEGG orthology group: K03671, thioredoxin 1 (inferred from 100% identity to eco:b3781)

MetaCyc: 100% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AA25 at UniProt or InterPro

Protein Sequence (109 amino acids)

>b3781 thioredoxin 1 (VIMSS) (Escherichia coli BW25113)
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN
IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA