Protein Info for b3765 in Escherichia coli BW25113

Name: yifB
Annotation: predicted bifunctional enzyme and transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 TIGR00368: Mg chelatase-like protein" amino acids 6 to 492 (487 residues), 834 bits, see alignment E=1.9e-255 PF13541: ChlI" amino acids 21 to 142 (122 residues), 150.5 bits, see alignment E=6.9e-48 PF01078: Mg_chelatase" amino acids 189 to 386 (198 residues), 298.6 bits, see alignment E=6.9e-93 PF00158: Sigma54_activat" amino acids 207 to 347 (141 residues), 20.5 bits, see alignment E=1.1e-07 PF07728: AAA_5" amino acids 212 to 349 (138 residues), 46.6 bits, see alignment E=1.2e-15 PF00493: MCM" amino acids 287 to 382 (96 residues), 34.6 bits, see alignment E=3.8e-12 PF13335: Mg_chelatase_C" amino acids 400 to 492 (93 residues), 103.3 bits, see alignment E=3.1e-33

Best Hits

Swiss-Prot: 100% identical to YIFB_ECOLI: Uncharacterized protein YifB (yifB) from Escherichia coli (strain K12)

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 100% identity to eco:b3765)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P22787 at UniProt or InterPro

Protein Sequence (506 amino acids)

>b3765 predicted bifunctional enzyme and transcriptional regulator (RefSeq) (Escherichia coli BW25113)
MSLSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGYEY
PAKKITINLAPADLPKEGGRYDLPIAIALLAASEQLTANKLDEYELVGELALTGALRGVP
GAISSATEAIKSGRKIIVAKDNEDEVGLINGEGCLIADHLQAVCAFLEGKHALERPKPTD
AVSRALQHDLSDVIGQEQGKRGLEITAAGGHNLLLIGPPGTGKTMLASRINGLLPDLSNE
EALESAAILSLVNAESVQKQWRQRPFRSPHHSASLTAMVGGGAIPGPGEISLAHNGVLFL
DELPEFERRTLDALREPIESGQIHLSRTRAKITYPARFQLVAAMNPSPTGHYQGNHNRCT
PEQTLRYLNRLSGPFLDRFDLSLEIPLPPPGILSKTVVPGESSATVKQRVMAARERQFKR
QNKLNAWLDSPEIRQFCKLESEDAMWLEGTLIHLGLSIRAWQRLLKVARTIADIDQSDII
TRQHLQEAVSYRAIDRLLIHLQKLLT