Protein Info for b3754 in Escherichia coli BW25113

Name: hsrA
Annotation: predicted multidrug or homocysteine efflux system (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 50 to 70 (21 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 394 to 417 (24 residues), see Phobius details amino acids 429 to 450 (22 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 406 (390 residues), 157.2 bits, see alignment E=5.7e-50 TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 18 to 433 (416 residues), 264.4 bits, see alignment E=9.6e-83

Best Hits

Swiss-Prot: 100% identical to HSRA_ECOLI: Probable transport protein HsrA (hsrA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3754)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P31474 at UniProt or InterPro

Protein Sequence (475 amino acids)

>b3754 predicted multidrug or homocysteine efflux system (NCBI) (Escherichia coli BW25113)
MSDKKKRSMAGLPWIAAMAFFMQALDATILNTALPAIAHSLNRSPLAMQSAIISYTLTVA
MLIPVSGWLADRFGTRRIFTLAVSLFTLGSLACALSNSLPQLVVFRVIQGIGGAMMMPVA
RLALLRAYPRNELLPVLNFVAMPGLVGPILGPVLGGVLVTWATWHWIFLINIPIGIAGLL
YARKHMPNFTTARRRFDITGFLLFGLSLVLFSSGIELFGEKIVASWIALTVIVTSIGLLL
LYILHARRTPNPLISLDLFKTRTFSIGIVGNIATRLGTGCVPFLMPLMLQVGFGYQAFIA
GCMMAPTALGSIIAKSMVTQVLRRLGYRHTLVGITVIIGLMIAQFSLQSPAMAIWMLILP
LFILGMAMSTQFTAMNTITLADLTDDNASSGNSVLAVTQQLSISLGVAVSAAVLRVYEGM
EGTTTVEQFHYTFITMGIITVASAAMFMLLKTTDGNNLIKRQRKSKPNRVPSESE