Protein Info for b3739 in Escherichia coli BW25113

Name: atpI
Annotation: membrane-bound ATP synthase, dispensable protein, affects expression of atpB (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details PF03899: ATP-synt_I" amino acids 13 to 108 (96 residues), 56.1 bits, see alignment E=2.2e-19

Best Hits

Swiss-Prot: 100% identical to ATPZ_ECOL6: ATP synthase protein I (atpI) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02116, ATP synthase protein I (inferred from 100% identity to eco:b3739)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ABC0 at UniProt or InterPro

Protein Sequence (126 amino acids)

>b3739 membrane-bound ATP synthase, dispensable protein, affects expression of atpB (VIMSS) (Escherichia coli BW25113)
MSVSLVSRNVARKLLLVQLLVVIASGLLFSLKDPFWGVSAISGGLAVFLPNVLFMIFAWR
HQAHTPAKGRVAWTFAFGEAFKVLAMLVLLVVALAVLKAVFLPLIVTWVLVLVVQILAPA
VINNKG