Protein Info for b3710 in Escherichia coli BW25113

Name: mdtL
Annotation: multidrug efflux system protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 40 to 58 (19 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 353 to 376 (24 residues), see Phobius details PF07690: MFS_1" amino acids 10 to 342 (333 residues), 153.3 bits, see alignment E=1.3e-48 PF06609: TRI12" amino acids 25 to 175 (151 residues), 28.4 bits, see alignment E=9.1e-11 PF00083: Sugar_tr" amino acids 35 to 177 (143 residues), 49.4 bits, see alignment E=5.1e-17

Best Hits

Swiss-Prot: 100% identical to MDTL_ECODH: Multidrug resistance protein MdtL (mdtL) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K08163, MFS transporter, DHA1 family, multidrug resistance protein (inferred from 100% identity to eco:b3710)

MetaCyc: 100% identical to efflux pump MdtL (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-341

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P31462 at UniProt or InterPro

Protein Sequence (391 amino acids)

>b3710 multidrug efflux system protein (NCBI) (Escherichia coli BW25113)
MSRFLICSFALVLLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMAAAMLFAGK
VADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTL
DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKE
TRPAAPAASDKPRENSESLLNRFFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEY
ATIMALTAGVSMTVSFSTPFALGIFKPRTLMITSQVLFLAAGITLAVSPSHAVSLFGITL
ICAGFSVGFGVAMSQALGPFSLRAGVASSTLGIAQVCGSSLWIWLAAVVGIGAWNMLIGI
LIACSIVSLLLIMFVAPGRPVAAHEEIHHHA