Protein Info for b3709 in Escherichia coli BW25113

Name: tnaB
Annotation: tryptophan transporter of low affinity (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 61 (24 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 192 to 218 (27 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 282 to 310 (29 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 382 to 408 (27 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 7 to 403 (397 residues), 509.7 bits, see alignment E=3.1e-157 TIGR00837: aromatic amino acid transport protein" amino acids 13 to 396 (384 residues), 516.5 bits, see alignment E=2.6e-159

Best Hits

Swiss-Prot: 100% identical to TNAB_ECOLI: Low affinity tryptophan permease (tnaB) from Escherichia coli (strain K12)

KEGG orthology group: K03836, low affinity tryptophan permease (inferred from 100% identity to eco:b3709)

MetaCyc: 100% identical to tryptophan:H+ symporter TnaB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-76

Predicted SEED Role

"Tryptophan-specific transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P23173 at UniProt or InterPro

Protein Sequence (415 amino acids)

>b3709 tryptophan transporter of low affinity (NCBI) (Escherichia coli BW25113)
MTDQAEKKHSAFWGVMVIAGTVIGGGMFALPVDLAGAWFFWGAFILIIAWFSMLHSGLLL
LEANLNYPVGSSFNTITKDLIGNTWNIISGITVAFVLYILTYAYISANGAIISETISMNL
GYHANPRIVGICTAIFVASVLWLSSLAASRITSLFLGLKIISFVIVFGSFFFQVDYSILR
DATSSTAGTSYFPYIFMALPVCLASFGFHGNIPSLIICYGKRKDKLIKSVVFGSLLALVI
YLFWLYCTMGNIPRESFKAIISSGGNVDSLVKSFLGTKQHGIIEFCLLVFSNLAVASSFF
GVTLGLFDYLADLFKIDNSHGGRFKTVLLTFLPPALLYLIFPNGFIYGIGGAGLCATIWA
VIIPAVLAIKARKKFPNQMFTVWGGNLIPAIVILFGITVILCWFGNVFNVLPKFG