Protein Info for b3702 in Escherichia coli BW25113

Name: dnaA
Annotation: chromosomal replication initiation protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF11638: DnaA_N" amino acids 4 to 64 (61 residues), 69.5 bits, see alignment E=4.8e-23 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 465 (460 residues), 622.7 bits, see alignment E=2.1e-191 PF00308: Bac_DnaA" amino acids 133 to 292 (160 residues), 251 bits, see alignment E=1.8e-78 PF01695: IstB_IS21" amino acids 168 to 269 (102 residues), 30 bits, see alignment E=1.1e-10 PF00004: AAA" amino acids 169 to 270 (102 residues), 26.5 bits, see alignment E=2.4e-09 PF08299: Bac_DnaA_C" amino acids 376 to 444 (69 residues), 113.4 bits, see alignment E=1.3e-36

Best Hits

Swiss-Prot: 100% identical to DNAA_ECO45: Chromosomal replication initiator protein DnaA (dnaA) from Escherichia coli O45:K1 (strain S88 / ExPEC)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to eco:b3702)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P03004 at UniProt or InterPro

Protein Sequence (467 amino acids)

>b3702 chromosomal replication initiation protein (NCBI) (Escherichia coli BW25113)
MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNIN
GLLTSFCGADAPQLRFEVGTKPVTQTPQAAVTSNVAAPAQVAQTQPQRAAPSTRSGWDNV
PAPAEPTYRSNVNVKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTH
LLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFF
ANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELE
TRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVR
EALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNH
SLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS