Protein Info for b3698 in Escherichia coli BW25113

Name: yidB
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF20159: YidB" amino acids 7 to 111 (105 residues), 73 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 100% identical to YIDB_ECOLI: Uncharacterized protein YidB (yidB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3698)

Predicted SEED Role

"FIG00638813: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P09996 at UniProt or InterPro

Protein Sequence (132 amino acids)

>b3698 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MGLFDEVVGAFLKGDAGKYQAILSWVEEQGGIQVLLEKLQSGGLGAILSTWLSNQQGNQS
VSGEQLESALGTNAVSDLGQKLGVDTSTASSLLAEQLPKIIDALSPQGEVSPQANNDLLS
AGMELLKGKLFR