Protein Info for b3653 in Escherichia coli BW25113

Name: gltS
Annotation: glutamate transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 52 (17 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 215 to 239 (25 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 369 to 394 (26 residues), see Phobius details TIGR00210: sodium/glutamate symporter" amino acids 2 to 397 (396 residues), 679.9 bits, see alignment E=5e-209 PF03616: Glt_symporter" amino acids 2 to 366 (365 residues), 547.8 bits, see alignment E=5.1e-169

Best Hits

Swiss-Prot: 100% identical to GLTS_SHIFL: Sodium/glutamate symporter (gltS) from Shigella flexneri

KEGG orthology group: K03312, glutamate:Na+ symporter, ESS family (inferred from 100% identity to eco:b3653)

MetaCyc: 100% identical to glutamate:sodium symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-122

Predicted SEED Role

"Sodium/glutamate symport protein" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AER8 at UniProt or InterPro

Protein Sequence (401 amino acids)

>b3653 glutamate transporter (NCBI) (Escherichia coli BW25113)
MFHLDTLATLVAATLTLLLGRKLVHSVSFLKKYTIPEPVAGGLLVALALLVLKKSMGWEV
NFDMSLRDPLMLAFFATIGLNANIASLRAGGRVVGIFLIVVVGLLVMQNAIGIGMASLLG
LDPLMGLLAGSITLSGGHGTGAAWSKLFIERYGFTNATEVAMACATFGLVLGGLIGGPVA
RYLVKHSTTPNGIPDDQEVPTAFEKPDVGRMITSLVLIETIALIAICLTVGKIVAQLLAG
TAFELPTFVCVLFVGVILSNGLSIMGFYRVFERAVSVLGNVSLSLFLAMALMGLKLWELA
SLALPMLAILVVQTIFMALYAIFVTWRMMGKNYDAAVLAAGHCGFGLGATPTAIANMQAI
TERFGPSHMAFLVVPMVGAFFIDIVNALVIKLYLMLPIFAG