Protein Info for b3649 in Escherichia coli BW25113

Name: rpoZ
Annotation: DNA-directed RNA polymerase subunit omega (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00690: DNA-directed RNA polymerase, omega subunit
  • amino acids 1 to 60 (60 residues), 102.8 bits, E=3.9e-34
• PF01192: RNA_pol_Rpb6
  • amino acids 8 to 59 (52 residues), 68.8 bits, E=1.6e-23

Best Hits

Swiss-Prot: 100% identical to RPOZ_SALAR: DNA-directed RNA polymerase subunit omega (rpoZ) from Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

KEGG orthology group: K03060, DNA-directed RNA polymerase subunit omega [EC: 2.7.7.6] (inferred from 100% identity to eco:b3649)

Predicted SEED Role

"DNA-directed RNA polymerase omega subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

See P0A800 at UniProt or InterPro

Protein Sequence (91 amino acids)

>b3649 DNA-directed RNA polymerase subunit omega (NCBI) (Escherichia coli BW25113)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR