Protein Info for b3628 in Escherichia coli BW25113

Name: rfaB
Annotation: UDP-D-galactose:(glucosyl)lipopolysaccharide-1, 6-D-galactosyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 13 to 166 (154 residues), 47.7 bits, E=2.7e-16
• PF00534: Glycos_transf_1
  • amino acids 175 to 323 (149 residues), 86.1 bits, E=3.2e-28
• PF13692: Glyco_trans_1_4
  • amino acids 180 to 317 (138 residues), 70.6 bits, E=2.6e-23

Best Hits

Swiss-Prot: 100% identical to RFAB_ECOLI: Lipopolysaccharide 1,6-galactosyltransferase (rfaB) from Escherichia coli (strain K12)

KEGG orthology group: K02840, UDP-D-galactose:(glucosyl)LPS alpha-1,6-D-galactosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to eco:b3628)

MetaCyc: 100% identical to UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase (Escherichia coli K-12 substr. MG1655)
2.4.1.-

Predicted SEED Role

"Lipopolysaccharide 1,6-galactosyltransferase (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

MetaCyc Pathways

• superpathway of Kdo₂-lipid A biosynthesis (24/25 steps found)
• lipid A-core biosynthesis (E. coli K-12) (9/10 steps found)
• lipid A-core biosynthesis (Salmonella) (8/10 steps found)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See P27127 at UniProt or InterPro

Protein Sequence (359 amino acids)

>b3628 UDP-D-galactose:(glucosyl)lipopolysaccharide-1, 6-D-galactosyltransferase (RefSeq) (Escherichia coli BW25113)
MKIAFIGEAVSGFGGMETVIRDVITTFRQQHIQSEMFFFCRNDKMDKGWLEGIKYSCSFS
NIRLGFLRRAKHIHALSKWLQEYQPDIVICIDVISCLFAAKARKKSGIDMPVFSWPHFSL
DHKKHAEYITCADYHLAISSGIKQQMINRGVAESTINVIFNPVETKDSVIPAPEEGETAT
FIYVGRMKFEGQKRVKDLLDGLSQAKGNWKLHVLGDGSDFEKCQAYGRELNIDDRIVWYG
WQQYPWELVQQDIEKVSALLLTSSFEGFPMTLLEALSWGIPCISADCVSGPADIIQPDVN
GHLYQPGDIAGFVTLLNKYIAGEIHIEHEKIPASIDEFYQSKYYDRLHKVIISAISRRK