Protein Info for b3624 in Escherichia coli BW25113

Name: rfaZ
Annotation: lipopolysaccharide core biosynthesis protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF27901: WaaZ_KDO_III" amino acids 6 to 255 (250 residues), 443 bits, see alignment E=1.5e-137 TIGR04437: 3-deoxy-D-manno-oct-2-ulosonate III transferase WaaZ" amino acids 6 to 256 (251 residues), 478.9 bits, see alignment E=1.6e-148

Best Hits

Swiss-Prot: 100% identical to RFAZ_ECOLI: Lipopolysaccharide core biosynthesis protein RfaZ (rfaZ) from Escherichia coli (strain K12)

KEGG orthology group: K12981, KDO transferase III [EC: 2.-.-.-] (inferred from 100% identity to eco:b3624)

MetaCyc: 100% identical to lipopolysaccharide core biosynthesis protein WaaZ (Escherichia coli K-12 substr. MG1655)
RXN-11326 [EC: 2.4.99.15]

Predicted SEED Role

"Lipopolysaccharide core biosynthesis protein RfaZ" in subsystem LOS core oligosaccharide biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P27241 at UniProt or InterPro

Protein Sequence (283 amino acids)

>b3624 lipopolysaccharide core biosynthesis protein (NCBI) (Escherichia coli BW25113)
MKNIRYIDKKDVENLIENKISDDVIIFLSGPTSQKTPLSVLRTKDIIAVNGSAQYLLSNN
IVPFIYVLTDVRFLHQRRDDFYKFSQRSRYTIVNVDVYEHASKEDKLYILQNCLVLRSFY
RREKGGFIKKIKFNILRQIHKELLISVPLSKKGRLVGFCKDISLGYCSCHTIAFAAIQIA
YSLKYARIICSGLDLTGSCSRFYDENKNPMPSELSRDLFKILPFFRFMHDNVKDINIYNL
SDDTAISYDVIPFIKLQDISAEESKDMTRKKMQYRTSTDSYAN