Protein Info for b3623 in Escherichia coli BW25113

Name: rfaK
Annotation: lipopolysaccharide core biosynthesis (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF01075: Glyco_transf_9" amino acids 274 to 332 (59 residues), 27.9 bits, see alignment E=7.1e-11

Best Hits

Swiss-Prot: 100% identical to WAAU_ECOLI: Lipopolysaccharide 1,2-N-acetylglucosaminetransferase (waaU) from Escherichia coli (strain K12)

KEGG orthology group: K03277, heptosyltransferase IV [EC: 2.4.-.-] (inferred from 100% identity to eco:b3623)

Predicted SEED Role

"Lipopolysaccharide 1,2-N-acetylglucosaminetransferase (EC 2.4.1.56)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-

Use Curated BLAST to search for 2.4.-.- or 2.4.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P27242 at UniProt or InterPro

Protein Sequence (357 amino acids)

>b3623 lipopolysaccharide core biosynthesis (NCBI) (Escherichia coli BW25113)
MRLGTFHKKKRFYINKIKINFLSFLFRNKINNQITDPAQVKSCLIIHDNNKLGDLIVLSS
IYRELYSKGVKITLLTNRKGGEFLSNNKNIFEFCIKESTGFLEMLTLCKHLRDLQFDIVL
DPFETMPSFKHSLILSSLKDSYILGFDHWYKRYYSFYHPHDECLKEHMSTRAIEILKHIY
GEGKFSTNYDLHLPVDVEDKIKEFIGDTRIVIINPLGAKKICRLTFEQIKVIYQEVKTHF
ENYRIIFTGLPQDLLTIPILEIETLPFDEFIYTVALTKYSDFVISVDTALVHIAAAYHKP
TLAFYPNSRTPEYPSHLIWSPNHHKSIQIVSPTYTVKDIDTETLTNSVKRLSCIDKK