Protein Info for b3622 in Escherichia coli BW25113

Name: rfaL
Annotation: O-antigen ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 60 (17 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 195 to 211 (17 residues), see Phobius details amino acids 217 to 233 (17 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details amino acids 397 to 414 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 205 to 354 (150 residues), 50 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 100% identical to RFAL_ECOLI: O-antigen ligase (rfaL) from Escherichia coli (strain K12)

KEGG orthology group: K02847, O-antigen ligase [EC: 6.-.-.-] (inferred from 100% identity to eco:b3622)

MetaCyc: 100% identical to O-antigen ligase (Escherichia coli K-12 substr. MG1655)
RXN-22510 [EC: 2.4.99.26]; 2.4.99.26 [EC: 2.4.99.26]

Predicted SEED Role

"O-antigen ligase" in subsystem LOS core oligosaccharide biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.-.-.-

Use Curated BLAST to search for 2.4.99.26 or 6.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P27243 at UniProt or InterPro

Protein Sequence (419 amino acids)

>b3622 O-antigen ligase (NCBI) (Escherichia coli BW25113)
MLTSFKLHSLKPYTLKSSMILEIITYILCFFSMIIAFVDNTFSIKIYNITAIVCLLSLIL
RGRQENYNIKNLILPLSIFLIGLLDLIWYSAFKVDNSPFRATYHSYLNTAKIFIFGSFIV
FLTLTSQLKSKKESVLYTLYSLSFLIAGYAMYINSIHENDRISFGVGTATGAAYSTMLIG
IVSGVAILYTKKNHPFLFLLNSCAVLYVLALTQTRATLLLFPIICVAALIAYYNKSPKKF
TSSIVLLIAILASIVIIFNKPIQNRYNEALNDLNSYTNANSVTSLGARLAMYEIGLNIFI
KSPFSFRSAESRAESMNLLVAEHNRLRGALEFSNVHLHNEIIEAGSLKGLMGIFSTLFLY
FSLFYIAYKKRALGLLILTLGIVGIGLSDVIIWARSIPIIIISAIVLLLVINNRNNTIN