Protein Info for b3609 in Escherichia coli BW25113

Name: secB
Annotation: export protein SecB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 TIGR00809: protein-export chaperone SecB" amino acids 5 to 147 (143 residues), 236.2 bits, see alignment E=5.5e-75 PF02556: SecB" amino acids 5 to 144 (140 residues), 196.1 bits, see alignment E=1.2e-62

Best Hits

Swiss-Prot: 100% identical to SECB_SHIBS: Protein-export protein SecB (secB) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K03071, preprotein translocase subunit SecB (inferred from 100% identity to eco:b3609)

Predicted SEED Role

"Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AG86 at UniProt or InterPro

Protein Sequence (155 amino acids)

>b3609 export protein SecB (NCBI) (Escherichia coli BW25113)
MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVL
RVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSR
GTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA