Protein Info for b3601 in Escherichia coli BW25113

Name: mtlR
Annotation: DNA-binding repressor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF05068: MtlR" amino acids 29 to 187 (159 residues), 222.9 bits, see alignment E=1.2e-70

Best Hits

Swiss-Prot: 100% identical to MTLR_ECOL6: Mannitol operon repressor (mtlR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02562, mannitol operon repressor (inferred from 100% identity to eco:b3601)

Predicted SEED Role

"Mannitol operon repressor" in subsystem Mannitol Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AF10 at UniProt or InterPro

Protein Sequence (195 amino acids)

>b3601 DNA-binding repressor (NCBI) (Escherichia coli BW25113)
MVDQAQDTLRPNNRLSDMQATMEQTQAFENRVLERLNAGKTVRSFLITAVELLTEAVNLL
VLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVINRQEYEDAELLMALREEL
NHDGNEYAFTDDEILGPFGELHCVAALPPPPQFEPADSSLYAMQIQRYQQAVRSTMVLSL
TELISKISLKKAFQK