Protein Info for b3592 in Escherichia coli BW25113

Name: yibF
Annotation: predicted glutathione S-transferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF02798: GST_N" amino acids 1 to 71 (71 residues), 33.2 bits, see alignment E=1.1e-11 PF13417: GST_N_3" amino acids 3 to 71 (69 residues), 43.8 bits, see alignment E=5.3e-15 PF13409: GST_N_2" amino acids 8 to 71 (64 residues), 52.3 bits, see alignment E=1.4e-17 PF00043: GST_C" amino acids 97 to 192 (96 residues), 52.6 bits, see alignment E=9.3e-18

Best Hits

Swiss-Prot: 100% identical to YIBF_ECOLI: Uncharacterized GST-like protein YibF (yibF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3592)

Predicted SEED Role

"Uncharacterized GST-like protein yibF" in subsystem Glutathione: Non-redox reactions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACA1 at UniProt or InterPro

Protein Sequence (202 amino acids)

>b3592 predicted glutathione S-transferase (NCBI) (Escherichia coli BW25113)
MKLVGSYTSPFVRKLSILLLEKGITFEFINELPYNADNGVAQFNPLGKVPVLVTEEGECW
FDSPIIAEYIELMNVAPAMLPRDPLESLRVRKIEALADGIMDAGLVSVREQARPAAQQSE
DELLRQREKINRSLDVLEGYLVDGTLKTDTVNLATIAIACAVGYLNFRRVAPGWCVDRPH
LVKLVENLFSRESFARTEPPKA