Protein Info for b3582 in Escherichia coli BW25113
Name: sgbU
Annotation: probable 3-hexulose-6-phosphate isomerase (VIMSS)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to SGBU_ECOLI: Putative L-ribulose-5-phosphate 3-epimerase SgbU (sgbU) from Escherichia coli (strain K12)
KEGG orthology group: K03082, hexulose-6-phosphate isomerase [EC: 5.-.-.-] (inferred from 100% identity to eco:b3582)MetaCyc: 59% identical to L-ribulose-5-phosphate 3-epimerase UlaE (Escherichia coli K-12 substr. MG1655)
L-ribulose-5-phosphate 3-epimerase. [EC: 5.1.3.22]
Predicted SEED Role
No annotation
MetaCyc Pathways
- L-ascorbate degradation II (bacterial, aerobic) (7/7 steps found)
- L-ascorbate degradation I (bacterial, anaerobic) (5/5 steps found)
- L-lyxose degradation (4/4 steps found)
- superpathway of pentose and pentitol degradation (18/42 steps found)
KEGG Metabolic Maps
- Ascorbate and aldarate metabolism
- Biosynthesis of steroids
- Carotenoid biosynthesis - General
- Lipopolysaccharide biosynthesis
- Pentose and glucuronate interconversions
Isozymes
Compare fitness of predicted isozymes for: 5.-.-.-, 5.1.3.22
Use Curated BLAST to search for 5.-.-.- or 5.1.3.22
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P37679 at UniProt or InterPro
Protein Sequence (286 amino acids)
>b3582 probable 3-hexulose-6-phosphate isomerase (VIMSS) (Escherichia coli BW25113) MRNHQLGIYEKALAKDLSWPERLVLAKSCGFDFVEMSVDETDERLSRLDWSAAQRTSLVA AMIETGVGIPSMCLSAHRRFPFGSRDEAVRERAREIMSKAIRLARDLGIRTIQLAGYDVY YEDHDEGTRQRFAEGLAWAVEQAAASQVMLAVEIMDTAFMNSISKWKKWDEMLASPWFTV YPDVGNLSAWGNDVPAELKLGIDRIAAIHLKDTQPVTGQSPGQFRDVPFGEGCVDFVGIF KTLHKLNYRGSFLIEMWTEKAKEPVLEIIQARRWIEARMQEAGFIC