Protein Info for b3540 in Escherichia coli BW25113

Name: dppF
Annotation: dipeptide transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00005: ABC_tran" amino acids 38 to 189 (152 residues), 115.7 bits, see alignment E=2.5e-37 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 240 to 324 (85 residues), 85.7 bits, see alignment E=8.7e-29 PF08352: oligo_HPY" amino acids 241 to 306 (66 residues), 73.4 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 100% identical to DPPF_ECOLI: Dipeptide transport ATP-binding protein DppF (dppF) from Escherichia coli (strain K12)

KEGG orthology group: K12372, dipeptide transport system ATP-binding protein (inferred from 100% identity to eco:b3540)

MetaCyc: 100% identical to dipeptide ABC transporter ATP binding subunit DppF (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppF (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37313 at UniProt or InterPro

Protein Sequence (334 amino acids)

>b3540 dipeptide transporter (NCBI) (Escherichia coli BW25113)
MSTQEATLQQPLLQAIDLKKHYPVKKGMFAPERLVKALDGVSFNLERGKTLAVVGESGCG
KSTLGRLLTMIEMPTGGELYYQGQDLLKHDPQAQKLRRQKIQIVFQNPYGSLNPRKKVGQ
ILEEPLLINTSLSKEQRREKALSMMAKVGLKTEHYDRYPHMFSGGQRQRIAIARGLMLDP
DVVIADEPVSALDVSVRAQVLNLMMDLQQELGLSYVFISHDLSVVEHIADEVMVMYLGRC
VEKGTKDQIFNNPRHPYTQALLSATPRLNPDDRRERIKLSGELPSPLNPPPGCAFNARCR
RRFGPCTQLQPQLKDYGGQLVACFAVDQDENPQR