Protein Info for b3508 in Escherichia coli BW25113

Name: yhiD
Annotation: predicted Mg(2+) transport ATPase inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details PF02308: MgtC" amino acids 9 to 136 (128 residues), 131.5 bits, see alignment E=2.1e-42 PF26539: ACT_YhiD_C" amino acids 146 to 215 (70 residues), 166.9 bits, see alignment E=8.8e-54

Best Hits

Swiss-Prot: 100% identical to YHID_ECOLI: Putative magnesium transporter YhiD (yhiD) from Escherichia coli (strain K12)

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 100% identity to eco:b3508)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFV2 at UniProt or InterPro

Protein Sequence (215 amino acids)

>b3508 predicted Mg(2+) transport ATPase inner membrane protein (NCBI) (Escherichia coli BW25113)
MTAEFIIRLILAAIACGAIGMERQMRGKGAGLRTHVLIGMGSALFMIVSKYGFADVLSLD
HVGLDPSRIAAQVVTGVGFIGAGNILVRNQNIVGLTTAADIWVTAAIGMVIGSGMYELGI
YGSVMTLLVLEVFHQLTFRLMNKNYHLQLTLVNGNTVSMLDWFKQQKIKTDLVSLQENED
HEVVAIDIQLHATTSIEDLLRLLKGMAGVKGVSIS