Protein Info for b3507 in Escherichia coli BW25113

Name: dctR
Annotation: protein involved in metabolism of C4-dicarboxylates (Katherine Huang)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF00196: GerE" amino acids 115 to 169 (55 residues), 36 bits, see alignment E=2.1e-13

Best Hits

Swiss-Prot: 100% identical to DCTR_ECOLI: HTH-type transcriptional regulator DctR (dctR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3507)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37195 at UniProt or InterPro

Protein Sequence (176 amino acids)

>b3507 protein involved in metabolism of C4-dicarboxylates (Katherine Huang) (Escherichia coli BW25113)
MFLIITRDTMFFTAMKNILSKGNVVHIQNEEEIDVMLHQNAFVIIDTLMNNVFHSNFLTQ
IERLKPVHVIIFSPFNIKRCLGKVPVTFVPRTITIIDFVALINGSYCSVPEAAVSLSRKQ
HQVLSCIANQMTTEDILEKLKISLKTFYCHKHNIMMILNLKRINELVRHQHIDYLV