Protein Info for b3505 in Escherichia coli BW25113

Name: insH-11
Annotation: IS5 transposase and trans-activator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF05598: DUF772" amino acids 28 to 122 (95 residues), 87.7 bits, see alignment E=6.1e-29 PF01609: DDE_Tnp_1" amino acids 150 to 324 (175 residues), 123.3 bits, see alignment E=1.2e-39

Best Hits

Swiss-Prot: 100% identical to INH10_ECOLI: Transposase InsH for insertion sequence element IS5R (insH10) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecd:ECDH10B_0617)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>b3505 IS5 transposase and trans-activator (NCBI) (Escherichia coli BW25113)
MFVIWSHRTGFIMSHQLTFADSEFSSKRRQTRKEIFLSRMEQILPWQNMVEVIEPFYPKA
GNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNF
RHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQRDPEMHQTK
KGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQ
REELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGF
VKARYKGLLKNDNQLAMLFTLANLFRADQMIRQWERSH