Protein Info for b3503 in Escherichia coli BW25113

Name: arsC
Annotation: arsenate reductase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00014: arsenate reductase (glutaredoxin)
  • amino acids 4 to 116 (113 residues), 137 bits, E=2e-44
• PF03960: ArsC
  • amino acids 7 to 114 (108 residues), 84.4 bits, E=2.7e-28

Best Hits

Swiss-Prot: 100% identical to ARSC_SHIFL: Arsenate reductase (arsC) from Shigella flexneri

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 100% identity to eco:b3503)

MetaCyc: 100% identical to arsenate reductase (Escherichia coli K-12 substr. MG1655)
Arsenate reductase (glutaredoxin). [EC: 1.20.4.1]

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

• arsenic detoxification (bacteria) (4/4 steps found)
• arsenic detoxification (plants) (5/6 steps found)
• arsenate detoxification III (2/2 steps found)
• arsenate detoxification I (4/6 steps found)
• arsenic detoxification (yeast) (4/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

See P0AB96 at UniProt or InterPro

Protein Sequence (141 amino acids)

>b3503 arsenate reductase (NCBI) (Escherichia coli BW25113)
MSNITIYHNPACGTSRNTLEMIRNSGTEPTIIHYLETPPTRDELVKLIADMGISVRALLR
KNVEPYEELGLAEDKFTDDRLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLEILPDAQ
KGAFSKEDGEKVVDEAGKRLK