Protein Info for b3501 in Escherichia coli BW25113

Name: arsR
Annotation: DNA-binding transcriptional repressor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF12840: HTH_20" amino acids 13 to 60 (48 residues), 32 bits, see alignment E=9.7e-12 PF01022: HTH_5" amino acids 15 to 60 (46 residues), 61.9 bits, see alignment E=4.3e-21

Best Hits

Swiss-Prot: 100% identical to ARSR_ECOLI: Arsenical resistance operon repressor (arsR) from Escherichia coli (strain K12)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 100% identity to eco:b3501)

MetaCyc: 100% identical to DNA-binding transcriptional repressor ArsR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Arsenical resistance operon repressor" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37309 at UniProt or InterPro

Protein Sequence (117 amino acids)

>b3501 DNA-binding transcriptional repressor (NCBI) (Escherichia coli BW25113)
MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLL
LDRKQGKWVHYRLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICS