Protein Info for b3484 in Escherichia coli BW25113

Name: yhhI
Annotation: predicted transposase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 124 to 141 (18 residues), see Phobius details PF13808: DDE_Tnp_1_assoc" amino acids 8 to 94 (87 residues), 114.9 bits, see alignment E=1.5e-37 PF01609: DDE_Tnp_1" amino acids 102 to 343 (242 residues), 103.5 bits, see alignment E=1.4e-33

Best Hits

Swiss-Prot: 100% identical to YHHI_ECOLI: H repeat-associated putative transposase YhhI (yhhI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3484)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P28912 at UniProt or InterPro

Protein Sequence (378 amino acids)

>b3484 predicted transposase (NCBI) (Escherichia coli BW25113)
MELKKLMEHISIIPDYRQTWKVEHKLSDILLLTICAVISGAEGWEDIEDFGETHLDFLKQ
YGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKDVIAIDGKTLRHSYDKS
RRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAIPELLNMLDIKGKIITTDAMGCQKDI
AEKIQKQGGDYLFAVKGTQGRLNKAFEEKFPLKELNNPEHDSYAISEKSHGREEIRLHIV
CDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPEMTVRYYISSADLTAEKFATAIR
NHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIAINILTNDKVFKAGLRRKMRK
AAMDRNYLASVLAGSGLS