Protein Info for b3475 in Escherichia coli BW25113

Name: acpT
Annotation: holo-(acyl carrier protein) synthase 2 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF01648: ACPS" amino acids 88 to 164 (77 residues), 43.7 bits, see alignment E=1.3e-15

Best Hits

Swiss-Prot: 100% identical to ACPT_ECOLI: 4'-phosphopantetheinyl transferase AcpT (acpT) from Escherichia coli (strain K12)

KEGG orthology group: K06133, 4'-phosphopantetheinyl transferase [EC: 2.7.8.-] (inferred from 100% identity to eco:b3475)

MetaCyc: 100% identical to holo-[acyl carrier protein] synthase 2 (Escherichia coli K-12 substr. MG1655)
Holo-[acyl-carrier-protein] synthase. [EC: 2.7.8.7]

Predicted SEED Role

"4'-phosphopantetheinyl transferase (EC 2.7.8.-)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-, 2.7.8.7

Use Curated BLAST to search for 2.7.8.- or 2.7.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37623 at UniProt or InterPro

Protein Sequence (195 amino acids)

>b3475 holo-(acyl carrier protein) synthase 2 (NCBI) (Escherichia coli BW25113)
MYRIVLGKVSTLSAAPLPPGLREQAPQGPRRERWLAGRALLSHTLSPLPEIIYGEQGKPA
FAPEMPLWFNLSHSGDDIALLLSDEGEVGCDIEVIRPRANWRWLANAVFSLGEHAEMDAV
HPDQQLEMFWRIWTRKEAIVKQRGGSAWQIVSVDSTYHSSLSVSHCQLENLSLAICTPTP
FTLTADSVQWIDSVN